Service hotline:+86-(0)-18115476705
Product details
Cat#: 125P06
Three Letter Code: H-Met-Ser-Pro-Tyr-Ser-Ser-Asp-Thr-Thr-Pro-Cys-Cys-Phe-Ala-Tyr-Ile-Ala-Arg-Pro-Leu-Pro-Arg-Ala-His-Ile-Lys-Glu-Tyr-Phe-Tyr-Thr-Ser-Gly-Lys-Cys-Ser-Asn-Pro-Ala-Val-Val-Phe-Val-Thr-Arg-Lys-Asn-Arg-Gln-Val-Cys-Ala-Asn-Pro-Glu-Lys-Lys-Trp-Val-Arg-Glu-Tyr-Ile-Asn-Ser-Leu-Glu-Met-Ser-OH trifluoroacetate salt(Disulfide bonds between Cys¹¹ and Cys³⁵/Cys¹² and Cys⁵¹)
One Letter Code: MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Molecular Formula: C₃₅₅H₅₄₃N₉₇O₁₀₁S₆
Relative Molecular Mass: 7978.21
CAS#: 1883816-50-9
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Cytokines/Chemokines & their Receptors|
Regenerative Medicine
Details: Synthetic product. Potent antagonist of RANTES and
macrophage inflammatory polypeptide-1α (MIP-1α).
Met-RANTES inhibited RANTES- or MIP-1α-induced chemotaxis
of promonocytic THP-1cells and T-cells. Although Met-RANTES
antagonized RANTES and MIP-1α with similar potency in the
chemotaxis response it showed a clear difference in the
cytokine-induced calcium mobilization assay.
1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.